PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN10328.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 536aa    MW: 59329.3 Da    PI: 5.5916
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN10328.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.2e-183784148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed++lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
       KHN10328.1 37 KGPWTSTEDDILVDYVKKHGEGNWNAVQKHTGLFRCGKSCRLRWANHL 84
                     79******************************************9986 PP

2Myb_DNA-binding46.31e-1490133146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++ +eE+ l++++++++G++ W++ a++++ gRt++++k++w++
       KHN10328.1  90 KGPFAAEEERLIAELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 133
                      78999*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0253284IPR017930Myb domain
SuperFamilySSF466891.05E-2936131IPR009057Homeodomain-like
SMARTSM007175.8E-153686IPR001005SANT/Myb domain
PfamPF002497.9E-163784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-233892IPR009057Homeodomain-like
CDDcd001671.20E-113984No hitNo description
PROSITE profilePS5129424.07885139IPR017930Myb domain
SMARTSM007175.6E-1589137IPR001005SANT/Myb domain
PfamPF002499.1E-1490133IPR001005SANT/Myb domain
CDDcd001671.60E-1092133No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2493138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MRRMKKDIED EVLPNDMSGA QLNDESYEGS AGIVLKKGPW TSTEDDILVD YVKKHGEGNW  60
NAVQKHTGLF RCGKSCRLRW ANHLRPNLKK GPFAAEEERL IAELHAKMGN KWARMAAHLP  120
GRTDNEIKNY WNTRIKRRQR AGLPLYPPEV SLHALQESQH SQSTGGLNGG DKMHPDFLQK  180
NSYEIHDAIF DSLKDNQGIL PYVHELSDIS VYGNKLKGLD SSQYCSFVPP TSPKRKRLKE  240
STIPFIDSCA MNKKDLYPFD QIQDNNSDKI AQSFGMQAPL DPGLSSHSSM CYSHSLSNGN  300
SSTSKPYEAM KLELPSLQYP ELDLGSWGSS PPPSLLESVD DFLQSPTAIS TLESDCSSPQ  360
NSGLLDALLY QAKTMSSSKN HCSDKSSNSS TATPGDRADS SILNVYETEW EDYADPVSPF  420
GATSILNECP ALRANANSLN GQLPVQTFTG NLPKLESVDQ VWTPNNENLT LSLLNITRPD  480
FLLASDWYDL GSGHCKNQTI TTDAATAFLG DDLATDLKHM TAGISKTMFE NPFQPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31351385107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5258970.0KC525897.1 Glycine max GAMBY1-like family protein (GAMYB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304541.10.0transcription factor GAMYB-like
TrEMBLA0A0B2PRI60.0A0A0B2PRI6_GLYSO; Transcription factor GAMYB
STRINGGLYMA13G25716.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-109myb domain protein 33
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]